PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn280691
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 691aa    MW: 76938.4 Da    PI: 5.4239
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn280691genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK383.2e-12578619344
      RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRW 44 
                   i+ledl+ +F l+ +d+Ak Lgv++ + Kr+CR++GI  W
  Achn280691 578 RVITLEDLQPHFGLKRADVAKILGVSVATFKRRCRRNGITWW 619
                 569************************************999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151911.217563648IPR003035RWP-RK domain
PfamPF020421.5E-12580619IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MSEADIENQT SLPKPRETFM DLDLDLDGSW PFDQIVSANP TSPFFISSSE QPFSPPWAFS  60
YDNGDELAED ATSTLAGGDP ESVTESEART GNKRRLSTPC LGLTPPIGYP DGSCVIKERM  120
TQALRYFKES TEQHVLAQFW APVKNGGRYV LTTSGQPFVL GPHGNGLRQY RMASLMYMFS  180
VDGESDGVLG LPGRVFQQKL PEWTPNVQYY SNKEDPRLTH ALYCNVQGSL ALPVFGPSGQ  240
FCIGVLELIM TSPKINYAPE IDKVCKALED ELNVLVNQIC NEGRQKALIE ILEILTVVCE  300
THKLPLAQTW VPCRHRSVLA NGGGLKKSCS SFDGSCMGQI CMSITEVAFY VVDAHMWGFR  360
EACAEHHLQK GQGVTGRAFA SHNLCFCEDI TQFCKTEYPL VHYARMFGLT SSFAICLRST  420
HTGNDDYILE FFLPHHIRDH RDQRTSLDSI LVTMKQHFWS LWVASGKELE EEGRCIEIIK  480
ASMDEKLDPG LQYDQISQIV ILPPDPEGHS LEEKISVEII NQVMDEKLDS SEQQLFVEFD  540
DATKSGQKAA MPMSCAAISL SKMKNAMETR ERKCGTKRVI TLEDLQPHFG LKRADVAKIL  600
GVSVATFKRR CRRNGITWWN GNECSPCFKP VPKHCEPPGE KTTPSCKIPS IRGLTGTGNQ  660
VLDSSIVDIE GNLQEQNSFQ VENASKEVSR *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010659716.10.0PREDICTED: protein NLP6-like
SwissprotQ8RWY40.0NLP6_ARATH; Protein NLP6
TrEMBLF6HU520.0F6HU52_VITVI; Putative uncharacterized protein
STRINGVIT_02s0025g02070.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13879911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein